PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00090481001
Common NameGSBRNA2T00090481001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 350aa    MW: 39799.5 Da    PI: 6.381
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00090481001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.4e-31186241156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+++LH+rF++a+++LGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  GSBRNA2T00090481001 186 KQRRCWSSQLHRRFLNALQHLGGPHVATPKQIREFMKVDGLTNDEVKSHLQKYRLH 241
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.113183243IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-27185244IPR009057Homeodomain-like
SuperFamilySSF466892.15E-16185244IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-28186241IPR006447Myb domain, plants
PfamPF002499.5E-6188239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MMKRLGNMDY NQKRERCGQY MEALEEERRK IHVFQRELPL CLDLVTQAIE ACKRELPEMA  60
IDNLYGQSEC SEQTTGECRP VVLEQFLTIK DLSTSNEEEE KDEEFDDEHG THDPDNDSED  120
KNMKSDWLKS VQLWNQPDPL LPKEERLQPK MIETVVKIDE SMRKDLMVNG GGEGRRKEAD  180
KDGGRKQRRC WSSQLHRRFL NALQHLGGPH VATPKQIREF MKVDGLTNDE VKSHLQKYRL  240
HTRRPSQTIP NNRNSQTQHF VVVGGLWGPQ SDYSTGKTTG GATNSSTTTT TGIYGAMAAP  300
PLPQWPSHSN FTQSIIVEEG SESHGEEVVV RCSSPAMSSS TRNHYVKKN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00090481001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013709803.10.0PREDICTED: uncharacterized protein LOC106413601
TrEMBLA0A078FNR90.0A0A078FNR9_BRANA; BnaC08g40480D protein
STRINGscaffold_101490.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.10.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]